MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000192

Record overview

MGPD IDMGP000192
Gene ID375
SpeciesHomo sapiens (Human)
Gene NameADP-ribosylation factor 1
Gene Symbol ARF1
Alternate namesADP-ribosylation factor 1;
Chromosome1
Map Location1q42
SummaryADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for ARF1

Proteins

ADP-ribosylation factor 1
Refseq ID:NP_001649
Protein GI:4502201
UniProt ID:P84077
mRNA ID:NM_001658
Length:181
RefSeq Status:
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERV
NEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
 
ADP-ribosylation factor 1
Refseq ID:NP_001019399
Protein GI:66879664
UniProt ID:P84077
mRNA ID:NM_001024228
Length:181
RefSeq Status:
Protein sequence is identical to GI:4502201 (mRNA isoform)
 
ADP-ribosylation factor 1
Refseq ID:NP_001019398
Protein GI:66879662
UniProt ID:P84077
mRNA ID:NM_001024227
Length:181
RefSeq Status:
Protein sequence is identical to GI:4502201 (mRNA isoform)
 
ADP-ribosylation factor 1
Refseq ID:NP_001019397
Protein GI:66879660
UniProt ID:P84077
mRNA ID:NM_001024226
Length:181
RefSeq Status:
Protein sequence is identical to GI:4502201 (mRNA isoform)
 
  logo