MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000258

Record overview

MGPD IDMGP000258
Gene ID514
SpeciesHomo sapiens (Human)
Gene NameATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
Gene Symbol ATP5E
SynonymsATPE; MC5DN3;
Alternate namesATP synthase subunit epsilon, mitochondrial; F(0)F(1)-ATPase; H(+)-transporting two-sector ATPase; mitochondrial ATP synthase epsilon chain; mitochondrial ATPase;
Chromosome20
Map Location20q13.32
SummaryThis gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. Read-through transcripts that include exons from this gene are expressed from the upstream gene SLMO2.[provided by RefSeq, Mar 2011]
OrthologsView orthologs and multiple alignments for ATP5E

Proteins

ATP synthase subunit epsilon, mitochondrial
Refseq ID:NP_008817
Protein GI:5901896
UniProt ID:P56381
mRNA ID:NM_006886
Length:51
RefSeq Status:
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
 
  logo