MGP Database

MGP000261

Record overview

MGPD IDMGP000261
Gene ID517
SpeciesHomo sapiens (Human)
Gene NameATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol ATP5G2
SynonymsATP5A;
Alternate namesATP synthase F(0) complex subunit C2, mitochondrial; ATP synthase c subunit; ATP synthase lipid-binding protein, mitochondrial; ATP synthase proteolipid P2; ATP synthase proton-transporting mitochondrial F(0) complex subunit C2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2; ATPase protein 9; ATPase subunit C; mitochondrial ATP synthase, subunit C (subunit 9), isoform 2;
Chromosome12
Map Location12q13.13
SummaryThis gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). There are three separate genes which encode subunit c of the proton channel and they specify precursors with different import sequences but identical mature proteins. The protein encoded by this gene is one of three precursors of subunit c. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene has multiple pseudogenes. [provided by RefSeq, Jun 2010]
OrthologsView orthologs and multiple alignments for ATP5G2

Proteins

ATP synthase F(0) complex subunit C2, mitochondrial isoform a precursor
Refseq ID:NP_001002031
Protein GI:50593533
UniProt ID:Q06055
mRNA ID:NM_001002031
Length:157
RefSeq Status:
MPELILSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGV
AGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
 
transit_peptide: 1..82
calculated_mol_wt: 8744
peptide sequence: 
MPELILSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISR

mat_peptide: 83..157
product: ATP synthase F(0) complex subunit C2, mitochondrial isoform a
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
 
ATP synthase F(0) complex subunit C2, mitochondrial isoform b precursor
Refseq ID:NP_005167
Protein GI:85794840
UniProt ID:Q06055
mRNA ID:NM_005176
Length:198
RefSeq Status:
MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSS
LAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
 
transit_peptide: 1..82
calculated_mol_wt: 8744
peptide sequence: 
MPELILSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISR

mat_peptide: 83..157
product: ATP synthase F(0) complex subunit C2, mitochondrial isoform a
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

transit_peptide: 1..123
calculated_mol_wt: 12923
peptide sequence: 
MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSS
LAVSCPLTSLVSSRSFQTSAISR mat_peptide: 124..198 product: ATP synthase F(0) complex subunit C2, mitochondrial isoform b calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
 
  logo