MGP Database

MGP000668

Record overview

MGPD ID	MGP000668
Gene ID	1366
Species	Homo sapiens (Human)
Gene Name	claudin 7
Gene Symbol	CLDN7
Synonyms	CLDN-7; CEPTRL2; CPETRL2; Hs.84359; claudin-1;
Alternate names	claudin-7; clostridium perfringens enterotoxin receptor-like 2;
Chromosome	17
Map Location	17p13.1
Summary	This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]
Orthologs	View orthologs and multiple alignments for CLDN7

Proteins

claudin-7 isoform 1 precursor

Refseq ID:	NP_001298
Protein GI:	153792186
UniProt ID:	O95471
mRNA ID:	NM_001307
Length:	211
RefSeq Status:

`MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATM GMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRS YPKSNSSKEYV`

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2452
peptide sequence: 
MANSGLQLLGFSMALLGWVGLVAC

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2452
peptide sequence: 
MANSGLQLLGFSMALLGWVGLVAC

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2452
peptide sequence: 
MANSGLQLLGFSMALLGWVGLVAC

claudin-7 isoform 1 precursor

Refseq ID:	NP_001171951
Protein GI:	297206811
UniProt ID:	O95471
mRNA ID:	NM_001185022
Length:	211
RefSeq Status:

Protein sequence is identical to GI:153792186 (mRNA isoform)

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2452
peptide sequence: 
MANSGLQLLGFSMALLGWVGLVAC

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2452
peptide sequence: 
MANSGLQLLGFSMALLGWVGLVAC

claudin-7 isoform 2 precursor

Refseq ID:	NP_001171952
Protein GI:	297206813
UniProt ID:	O95471
mRNA ID:	NM_001185023
Length:	145
RefSeq Status:

`MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATM GMKCTRCGGDDKVKKARIAMGGGIIFIVAGMSLALPSLLAGQGLP`

`sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2452 peptide sequence: MANSGLQLLGFSMALLGWVGLVAC`