MGP Database

MGP000710

Record overview

MGPD IDMGP000710
Gene ID1471
SpeciesHomo sapiens (Human)
Gene Namecystatin C
Gene Symbol CST3
SynonymsARMD11;
Alternate namescystatin-C; cystatin 3; cystatin-3; gamma-trace; post-gamma-globulin; bA218C14.4 (cystatin C); neuroendocrine basic polypeptide;
Chromosome20
Map Location20p11.21
SummaryThe cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. In addition, this protein has been shown to have an antimicrobial function, inhibiting the replication of herpes simplex virus. Alternative splicing results in multiple transcript variants encoding a single protein. [provided by RefSeq, Nov 2014]
OrthologsView orthologs and multiple alignments for CST3

Proteins

cystatin-C precursor
Refseq ID:NP_000090
Protein GI:4503107
UniProt ID:P01034
mRNA ID:NM_000099
Length:146
RefSeq Status:
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCT
KTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
 
sig_peptide: 1..26
calculated_mol_wt: 2470
peptide sequence: 
MAGPLRAPLLLLAILAVALAVSPAAG

mat_peptide: 27..146
product: cystatin-C
experiment: DESCRIPTION:antimicrobial peptide[PMID: 2153254]
calculated_mol_wt: 13347
peptide sequence: 
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQ
IYAVPWQGTMTLSKSTCQDA sig_peptide: 1..26 calculated_mol_wt: 2470 peptide sequence: MAGPLRAPLLLLAILAVALAVSPAAG mat_peptide: 27..146 product: cystatin-C experiment: DESCRIPTION:antimicrobial peptide[PMID: 2153254] calculated_mol_wt: 13347 peptide sequence: SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQ
IYAVPWQGTMTLSKSTCQDA
 
cystatin-C precursor
Refseq ID:NP_001275543
Protein GI:568599832
UniProt ID:P01034
mRNA ID:NM_001288614
Length:146
RefSeq Status:
Protein sequence is identical to GI:4503107 (mRNA isoform)
 
sig_peptide: 1..26
calculated_mol_wt: 2470
peptide sequence: 
MAGPLRAPLLLLAILAVALAVSPAAG

mat_peptide: 27..146
product: cystatin-C
experiment: DESCRIPTION:antimicrobial peptide[PMID: 2153254]
calculated_mol_wt: 13347
peptide sequence: 
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQ
IYAVPWQGTMTLSKSTCQDA
 
  logo