MGP Database

MGP000818

Record overview

MGPD ID	MGP000818
Gene ID	1672
Species	Homo sapiens (Human)
Gene Name	defensin, beta 1
Gene Symbol	DEFB1
Synonyms	BD1; HBD1; DEFB-1; DEFB101;
Alternate names	beta-defensin 1; BD-1; beta-defensin-1;
Chromosome	8
Map Location	8p23.1
Summary	Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for DEFB1

Proteins

beta-defensin 1 preproprotein

Refseq ID:	NP_005209
Protein GI:	4885181
UniProt ID:	P60022
mRNA ID:	NM_005218
Length:	68
RefSeq Status:

`MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK`

sig_peptide: 1..21
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2363
peptide sequence: 
MRTSYLLLFTLCLLLSEMASG

mat_peptide: 33..68
product: beta-defensin 1
experiment: DESCRIPTION:antimicrobial peptide[PMID: 20100591]
calculated_mol_wt: 3935
peptide sequence: 
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK