MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001110

Record overview

MGPD IDMGP001110
Gene ID2495
SpeciesHomo sapiens (Human)
Gene Nameferritin, heavy polypeptide 1
Gene Symbol FTH1
SynonymsFHC; FTH; HFE5; PLIF; FTHL6; PIG15;
Alternate namesferritin heavy chain; apoferritin; cell proliferation-inducing gene 15 protein; ferritin H subunit; placenta immunoregulatory factor; proliferation-inducing protein 15;
Chromosome11
Map Location11q13
EC Number1.16.3.1
SummaryThis gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for FTH1

Proteins

ferritin heavy chain
Refseq ID:NP_002023
Protein GI:56682959
UniProt ID:P02794
mRNA ID:NM_002032
Length:183
RefSeq Status:
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNA
MECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES
 
  logo