MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001351

Record overview

MGPD IDMGP001351
Gene ID2941
SpeciesHomo sapiens (Human)
Gene Nameglutathione S-transferase alpha 4
Gene Symbol GSTA4
SynonymsGTA4; GSTA4-4;
Alternate namesglutathione S-transferase A4; GST class-alpha member 4; S-(hydroxyalkyl)glutathione lyase A4; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A4; glutathione S-transferase A4-4; glutathione transferase A4-4;
Chromosome6
Map Location6p12.1
EC Number2.5.1.18
SummaryCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for GSTA4

Proteins

glutathione S-transferase A4
Refseq ID:NP_001503
Protein GI:4504173
UniProt ID:O15217
mRNA ID:NM_001512
Length:222
RefSeq Status:
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTL
DLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEP
GSKKKPPPDEIYVRTVYNIFRP
 
  logo