MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001356

Record overview

MGPD IDMGP001356
Gene ID2949
SpeciesHomo sapiens (Human)
Gene Nameglutathione S-transferase mu 5
Gene Symbol GSTM5
SynonymsGTM5; GSTM5-5;
Alternate namesglutathione S-transferase Mu 5; GST class-mu 5; S-(hydroxyalkyl)glutathione lyase M5; glutathione S-alkyltransferase M5; glutathione S-aralkyltransferase M5; glutathione S-aryltransferase M5; glutathione S-transferase M5;
Chromosome1
Map Location1p13.3
EC Number2.5.1.18
SummaryCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for GSTM5

Proteins

glutathione S-transferase Mu 5
Refseq ID:NP_000842
Protein GI:23065563
UniProt ID:P46439
mRNA ID:NM_000851
Length:218
RefSeq Status:
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDIL
ENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKS
SQFLRGLLFGKSATWNSK
 
  logo