MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001481

Record overview

MGPD IDMGP001481
Gene ID3178
SpeciesHomo sapiens (Human)
Gene Nameheterogeneous nuclear ribonucleoprotein A1
Gene Symbol HNRNPA1
SynonymsALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1;
Alternate namesheterogeneous nuclear ribonucleoprotein A1; Putative heterogeneous nuclear ribonucleoprotein A1-like 3; helix-destabilizing protein; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1-like 3; hnRNP core protein A1; hnRNP core protein A1-like 3; nuclear ribonucleoprotein particle A1 protein; single-strand DNA-binding protein UP1; single-strand RNA-binding protein;
Chromosome12
Map Location12q13.1
SummaryThis gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HNRNPA1

Proteins

heterogeneous nuclear ribonucleoprotein A1 isoform a
Refseq ID:NP_002127
Protein GI:4504445
UniProt ID:P09651
mRNA ID:NM_002136
Length:320
RefSeq Status:
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGA
HLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSG
NFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPR
NQGGYGGSSSSSSYGSGRRF
 
heterogeneous nuclear ribonucleoprotein A1 isoform b
Refseq ID:NP_112420
Protein GI:14043070
UniProt ID:P09651
mRNA ID:NM_031157
Length:372
RefSeq Status:
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGA
HLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSG
NFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
 
  logo