MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001715

Record overview

MGPD IDMGP001715
Gene ID3753
SpeciesHomo sapiens (Human)
Gene Namepotassium channel, voltage gated subfamily E regulatory beta subunit 1
Gene Symbol KCNE1
SynonymsISK; JLNS; LQT5; MinK; JLNS2; LQT2/5;
Alternate namespotassium voltage-gated channel subfamily E member 1; IKs producing slow voltage-gated potassium channel subunit beta Mink; cardiac delayed rectifier potassium channel protein; delayed rectifier potassium channel subunit IsK; minimal potassium channel; potassium voltage-gated channel, Isk-related family, member 1; potassium voltage-gated channel, Isk-related subfamily, member 1; voltage gated potassiun channel accessory subunit;
Chromosome21
Map Location21q22.12
SummaryThe product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for KCNE1

Proteins

potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_001121140
Protein GI:189095237
UniProt ID:P15382
mRNA ID:NM_001127668
Length:129
RefSeq Status:
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL
ESYRSCYVVENHLAIEQPNTHLPETKPSP
 
potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_001257331
Protein GI:393715100
UniProt ID:P15382
mRNA ID:NM_001270402
Length:129
RefSeq Status:
Protein sequence is identical to GI:189095237 (mRNA isoform)
 
potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_001121142
Protein GI:189095241
UniProt ID:P15382
mRNA ID:NM_001127670
Length:129
RefSeq Status:
Protein sequence is identical to GI:189095237 (mRNA isoform)
 
potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_001121141
Protein GI:189095239
UniProt ID:P15382
mRNA ID:NM_001127669
Length:129
RefSeq Status:
Protein sequence is identical to GI:189095237 (mRNA isoform)
 
potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_000210
Protein GI:60218915
UniProt ID:P15382
mRNA ID:NM_000219
Length:129
RefSeq Status:
Protein sequence is identical to GI:189095237 (mRNA isoform)
 
potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_001257334
Protein GI:393715106
UniProt ID:P15382
mRNA ID:NM_001270405
Length:129
RefSeq Status:
Protein sequence is identical to GI:189095237 (mRNA isoform)
 
potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_001257332
Protein GI:393715102
UniProt ID:P15382
mRNA ID:NM_001270403
Length:129
RefSeq Status:
Protein sequence is identical to GI:189095237 (mRNA isoform)
 
potassium voltage-gated channel subfamily E member 1
Refseq ID:NP_001257333
Protein GI:393715104
UniProt ID:P15382
mRNA ID:NM_001270404
Length:129
RefSeq Status:
Protein sequence is identical to GI:189095237 (mRNA isoform)
 
  logo