MGP Database

MGP001907

Record overview

MGPD ID	MGP001907
Gene ID	4218
Species	Homo sapiens (Human)
Gene Name	RAB8A, member RAS oncogene family
Gene Symbol	RAB8A
Synonyms	MEL; RAB8;
Alternate names	ras-related protein Rab-8A; mel transforming oncogene (RAB8 homolog); mel transforming oncogene (derived from cell line NK14); mel transforming oncogene (derived from cell line NK14)- RAB8 homolog; oncogene c-mel; ras-associated protein RAB8;
Chromosome	19
Map Location	19p13.1
Summary	The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for RAB8A

Proteins

ras-related protein Rab-8A

Refseq ID:	NP_005361
Protein GI:	16933567
UniProt ID:	P61006
mRNA ID:	NM_005370
Length:	207
RefSeq Status:

`MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIR NWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS FFRCVLL`

mat_peptide: 1..204
product: Ras-related protein Rab-8A
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P61006.1)
calculated_mol_wt: 23343
peptide sequence: 
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIR
NWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS
FFRC