MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002038

Record overview

MGPD IDMGP002038
Gene ID4694
SpeciesHomo sapiens (Human)
Gene NameNADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Gene Symbol NDUFA1
SynonymsMWFE; ZNF183; CI-MWFE;
Alternate namesNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1; NADH oxidoreductase subunit MWFE; NADH-ubiquinone oxidoreductase MWFE subunit; NADH:ubiquinone oxidoreductase (complex 1); complex I MWFE subunit; complex I-MWFE; type I dehydrogenase;
ChromosomeX
Map LocationXq24
SummaryThe human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for NDUFA1

Proteins

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Refseq ID:NP_004532
Protein GI:4758770
UniProt ID:O15239
mRNA ID:NM_004541
Length:70
RefSeq Status:
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
 
  logo