MGP Database

MGP002411

Record overview

MGPD ID	MGP002411
Gene ID	5552
Species	Homo sapiens (Human)
Gene Name	serglycin
Gene Symbol	SRGN
Synonyms	PPG; PRG; PRG1;
Alternate names	serglycin; hematopoetic proteoglycan core peptide; hematopoetic proteoglycan core protein; hematopoietic proteoglycan core protein; p.PG; platelet proteoglycan core protein; proteoglycan 1, secretory granule; proteoglycan protein core for mast cell secretory granule; secretory granule proteoglycan core peptide; secretory granule proteoglycan core protein; serglycin proteoglycan;
Chromosome	10
Map Location	10q22.1
Summary	This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene. [provided by RefSeq, Jul 2010]
Orthologs	View orthologs and multiple alignments for SRGN

Proteins

serglycin precursor

Refseq ID:	NP_002718
Protein GI:	45935371
UniProt ID:	P10124
mRNA ID:	NM_002727
Length:	158
RefSeq Status:

`MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGS GSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML`

sig_peptide: 1..27
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2958
peptide sequence: 
MMQKLLKCSRLVLALALILVLESSVQG

mat_peptide: 28..158
product: serglycin
calculated_mol_wt: 14712
peptide sequence: 
YPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESD
AFHDNLRSLDRNLPSDSQDLGQHGLEEDFML