MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002475

Record overview

MGPD IDMGP002475
Gene ID5688
SpeciesHomo sapiens (Human)
Gene Nameproteasome (prosome, macropain) subunit, alpha type, 7
Gene Symbol PSMA7
SynonymsC6; HSPC; RC6-1; XAPC7;
Alternate namesproteasome subunit alpha type-7; proteasome subunit RC6-1; proteasome subunit XAPC7; proteasome subunit alpha 4;
Chromosome20
Map Location20q13.33
EC Number3.4.25.1
SummaryThe 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. [provided by RefSeq, Jul 2012]
OrthologsView orthologs and multiple alignments for PSMA7

Proteins

proteasome subunit alpha type-7
Refseq ID:NP_002783
Protein GI:4506189
UniProt ID:O14818
mRNA ID:NM_002792
Length:248
RefSeq Status:
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED
PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQ
SGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS
 
  logo