MGP Database

MGP002556

Record overview

MGPD ID	MGP002556
Gene ID	5872
Species	Homo sapiens (Human)
Gene Name	RAB13, member RAS oncogene family
Gene Symbol	RAB13
Synonyms	GIG4;
Alternate names	ras-related protein Rab-13; RAS-associated protein RAB13; cell growth-inhibiting gene 4 protein; growth-inhibiting gene 4 protein;
Chromosome	1
Map Location	1q21.2
Summary	This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. [provided by RefSeq, Jan 2013]
Orthologs	View orthologs and multiple alignments for RAB13

Proteins

ras-related protein Rab-13 isoform 1

Refseq ID:	NP_002861
Protein GI:	4506363
UniProt ID:	P51153
mRNA ID:	NM_002870
Length:	203
RefSeq Status:

`MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQ NWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKC SLG`

mat_peptide: 1..200
product: Ras-related protein Rab-13
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P51153.1)
calculated_mol_wt: 22517
peptide sequence: 
MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQ
NWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKC

ras-related protein Rab-13 isoform 2

Refseq ID:	NP_001258967
Protein GI:	440309849
UniProt ID:	P51153
mRNA ID:	NM_001272038
Length:	122
RefSeq Status:

`MGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNG NKPPSTDLKTCDKKNTNKCSLG`