MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002697

Record overview

MGPD IDMGP002697
Gene ID6192
SpeciesHomo sapiens (Human)
Gene Nameribosomal protein S4, Y-linked 1
Gene Symbol RPS4Y1
SynonymsS4; RPS4Y;
Alternate names40S ribosomal protein S4, Y isoform 1; 40S ribosomal protein S4, Y; ribosomal protein S4Y;
ChromosomeY
Map LocationYp11.3
SummaryCytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes ribosomal protein S4, a component of the 40S subunit. Ribosomal protein S4 is the only ribosomal protein known to be encoded by more than one gene, namely this gene and ribosomal protein S4, X-linked (RPS4X). The 2 isoforms encoded by these genes are not identical, but are functionally equivalent. Ribosomal protein S4 belongs to the S4E family of ribosomal proteins. It has been suggested that haploinsufficiency of the ribosomal protein S4 genes plays a role in Turner syndrome; however, this hypothesis is controversial. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for RPS4Y1

Proteins

40S ribosomal protein S4, Y isoform 1
Refseq ID:NP_000999
Protein GI:4506727
UniProt ID:P22090
mRNA ID:NM_001008
Length:263
RefSeq Status:
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFR
LVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRER
HPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG
 
  logo