MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002788

Record overview

MGPD IDMGP002788
Gene ID6373
SpeciesHomo sapiens (Human)
Gene Namechemokine (C-X-C motif) ligand 11
Gene Symbol CXCL11
SynonymsIP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B;
Alternate namesC-X-C motif chemokine 11; beta-R1; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine B11; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; small-inducible cytokine B11;
Chromosome4
Map Location4q21.2
SummaryChemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]
OrthologsView orthologs and multiple alignments for CXCL11

Proteins

C-X-C motif chemokine 11 isoform 1 precursor
Refseq ID:NP_005400
Protein GI:4885589
UniProt ID:O14625
mRNA ID:NM_005409
Length:94
RefSeq Status:
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
 
sig_peptide: 1..21
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2076
peptide sequence: 
MSVKGMAIALAVILCATVVQG

mat_peptide: 22..106
product: C-X-C motif chemokine 11 isoform 2
calculated_mol_wt: 9739
peptide sequence: 
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKLKERIFKNIKTYEVLEKSI

sig_peptide: 1..21
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2076
peptide sequence: 
MSVKGMAIALAVILCATVVQG

mat_peptide: 22..94
product: C-X-C motif chemokine 11 isoform 1
experiment: DESCRIPTION:antimicrobial peptide[PMID: 12949249]
calculated_mol_wt: 8307
peptide sequence: 
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
 
C-X-C motif chemokine 11 isoform 2 precursor
Refseq ID:NP_001289052
Protein GI:693074655
UniProt ID:O14625
mRNA ID:NM_001302123
Length:106
RefSeq Status:
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKLKERIFKNIKTYE
VLEKSI
 
sig_peptide: 1..21
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2076
peptide sequence: 
MSVKGMAIALAVILCATVVQG

mat_peptide: 22..106
product: C-X-C motif chemokine 11 isoform 2
calculated_mol_wt: 9739
peptide sequence: 
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKLKERIFKNIKTYEVLEKSI
 
  logo