MGP Database

MGP002929

Record overview

MGPD ID	MGP002929
Gene ID	6612
Species	Homo sapiens (Human)
Gene Name	small ubiquitin-like modifier 3
Gene Symbol	SUMO3
Synonyms	SMT3A; Smt3B; SMT3H1; SUMO-3;
Alternate names	small ubiquitin-related modifier 3; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 3; ubiquitin-like protein SMT3B;
Chromosome	21
Map Location	21q22.3
Summary	This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]
Orthologs	View orthologs and multiple alignments for SUMO3

Proteins

small ubiquitin-related modifier 3 isoform 1 precursor

Refseq ID:	NP_008867
Protein GI:	48928058
UniProt ID:	P55854
mRNA ID:	NM_006936
Length:	103
RefSeq Status:

`MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAG HSF`

mat_peptide: 1..92
product: Small ubiquitin-related modifier 3
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P55854.2)
calculated_mol_wt: 10525
peptide sequence: 
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

small ubiquitin-related modifier 3 isoform 2

Refseq ID:	NP_001273345
Protein GI:	556695502
UniProt ID:	P55854
mRNA ID:	NM_001286416
Length:	141
RefSeq Status:

`MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQVRHLAPPQSLPVCALVLCVPGIPRARASRGWTQMQLPEGLSMRQIRFRFD GQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF`