MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003162

Record overview

MGPD IDMGP003162
Gene ID7134
SpeciesHomo sapiens (Human)
Gene Nametroponin C type 1 (slow)
Gene Symbol TNNC1
SynonymsTNC; TN-C; TNNC; CMD1Z; CMH13;
Alternate namestroponin C, slow skeletal and cardiac muscles; cardiac troponin C; slow twitch skeletal/cardiac muscle troponin C; troponin C1, slow;
Chromosome3
Map Location3p21.1
SummaryTroponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq, Oct 2008]
OrthologsView orthologs and multiple alignments for TNNC1

Proteins

troponin C, slow skeletal and cardiac muscles
Refseq ID:NP_003271
Protein GI:4507615
UniProt ID:P63316
mRNA ID:NM_003280
Length:161
RefSeq Status:
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDL
FRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
 
  logo