MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003164

Record overview

MGPD IDMGP003164
Gene ID7136
SpeciesHomo sapiens (Human)
Gene Nametroponin I type 2 (skeletal, fast)
Gene Symbol TNNI2
SynonymsDA2B; FSSV; fsTnI; AMCD2B;
Alternate namestroponin I, fast skeletal muscle; troponin I fast twitch 2; troponin I, fast-twitch isoform; troponin I, fast-twitch skeletal muscle isoform; troponin I, skeletal, fast;
Chromosome11
Map Location11p15.5
SummaryThis gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]
OrthologsView orthologs and multiple alignments for TNNI2

Proteins

troponin I, fast skeletal muscle isoform 1
Refseq ID:NP_001139301
Protein GI:224967057
UniProt ID:P48788
mRNA ID:NM_001145829
Length:182
RefSeq Status:
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
FDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
 
troponin I, fast skeletal muscle isoform 1
Refseq ID:NP_003273
Protein GI:4507621
UniProt ID:P48788
mRNA ID:NM_003282
Length:182
RefSeq Status:
Protein sequence is identical to GI:224967057 (mRNA isoform)
 
troponin I, fast skeletal muscle isoform 2
Refseq ID:NP_001139313
Protein GI:224967106
UniProt ID:P48788
mRNA ID:NM_001145841
Length:182
RefSeq Status:
MSQCKKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
FDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES
 
  logo