MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003747

Record overview

MGPD IDMGP003747
Gene ID8915
SpeciesHomo sapiens (Human)
Gene NameB-cell CLL/lymphoma 10
Gene Symbol BCL10
SynonymsCLAP; mE10; CIPER; IMD37; c-E10; CARMEN;
Alternate namesB-cell lymphoma/leukemia 10; CARD containing molecule enhancing NF-kB; CARD-containing apoptotic signaling protein; CARD-containing molecule enhancing NF-kappa-B; CARD-containing proapoptotic protein; CED-3/ICH-1 prodomain homologous E10-like regulator; cCARMEN; caspase-recruiting domain-containing protein; cellular homolog of vCARMEN; cellular-E10; hCLAP; mammalian CARD-containing adapter molecule E10;
Chromosome1
Map Location1p22
SummaryThis gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for BCL10

Proteins

B-cell lymphoma/leukemia 10
Refseq ID:NP_003912
Protein GI:4502379
UniProt ID:O95999
mRNA ID:NM_003921
Length:233
RefSeq Status:
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKIT
DEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGA
PPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ
 
  logo