MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003922

Record overview

MGPD IDMGP003922
Gene ID9491
SpeciesHomo sapiens (Human)
Gene Nameproteasome (prosome, macropain) inhibitor subunit 1 (PI31)
Gene Symbol PSMF1
SynonymsPI31;
Alternate namesproteasome inhibitor PI31 subunit; hPI31; proteasome inhibitor hP131 subunit;
Chromosome20
Map Location20p13
SummaryThe 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for PSMF1

Proteins

proteasome inhibitor PI31 subunit
Refseq ID:NP_006805
Protein GI:145611426
UniProt ID:Q92530
mRNA ID:NM_006814
Length:271
RefSeq Status:
MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQ
VADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDP
FGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL
 
proteasome inhibitor PI31 subunit
Refseq ID:NP_848693
Protein GI:145611430
UniProt ID:Q92530
mRNA ID:NM_178578
Length:271
RefSeq Status:
Protein sequence is identical to GI:145611426 (mRNA isoform)
 
  logo