MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004078

Record overview

MGPD IDMGP004078
Gene ID9992
SpeciesHomo sapiens (Human)
Gene Namepotassium channel, voltage gated subfamily E regulatory beta subunit 2
Gene Symbol KCNE2
SynonymsLQT5; LQT6; ATFB4; MIRP1;
Alternate namespotassium voltage-gated channel subfamily E member 2; cardiac voltage-gated potassium channel accessory subunit 2; minK-related peptide 1; minK-related peptide-1; minimum potassium ion channel-related peptide 1; potassium channel subunit beta MiRP1; potassium channel subunit, MiRP1; potassium voltage-gated channel, Isk-related family, member 2; voltage-gated K+ channel subunit MIRP1;
Chromosome21
Map Location21q22.12
SummaryVoltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for KCNE2

Proteins

potassium voltage-gated channel subfamily E member 2
Refseq ID:NP_751951
Protein GI:27436978
UniProt ID:Q9Y6J6
mRNA ID:NM_172201
Length:123
RefSeq Status:
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQI
LNLEESKATIHENIGAAGFKMSP
 
  logo