MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004413

Record overview

MGPD IDMGP004413
Gene ID10952
SpeciesHomo sapiens (Human)
Gene NameSec61 beta subunit
Gene Symbol SEC61B
Alternate namesprotein transport protein Sec61 subunit beta; Sec61 complex, beta subunit; protein translocation complex beta; protein transport protein SEC61 beta subunit;
Chromosome9
Map Location9q22.33
SummaryThe Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for SEC61B

Proteins

protein transport protein Sec61 subunit beta
Refseq ID:NP_006799
Protein GI:5803165
UniProt ID:P60468
mRNA ID:NM_006808
Length:96
RefSeq Status:
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
 
  logo