MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004457

Record overview

MGPD IDMGP004457
Gene ID11126
SpeciesHomo sapiens (Human)
Gene NameCD160 molecule
Gene Symbol CD160
SynonymsNK1; BY55; NK28;
Alternate namesCD160 antigen; CD160 transmembrane isoform; CD160-delta Ig; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member;
Chromosome1
Map Location1q21.1
SummaryCD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for CD160

Proteins

CD160 antigen precursor
Refseq ID:NP_008984
Protein GI:5901910
UniProt ID:O95971
mRNA ID:NM_007053
Length:181
RefSeq Status:
MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTIS
QVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
 
sig_peptide: 1..26
inference: non-experimental evidence, no additional details recorded
note: Potential; propagated from UniProtKB/Swiss-Prot (O95971.1)
calculated_mol_wt: 2617
peptide sequence: 
MLLEPGRGCCALAILLAIVDIQSGGC

mat_peptide: 27..159
product: CD160 antigen
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (O95971.1)
calculated_mol_wt: 14796
peptide sequence: 
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGH
FFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
 
  logo