MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004538

Record overview

MGPD IDMGP004538
Gene ID22914
SpeciesHomo sapiens (Human)
Gene Namekiller cell lectin-like receptor subfamily K, member 1
Gene Symbol KLRK1
SynonymsKLR; CD314; NKG2D; NKG2-D; D12S2489E;
Alternate namesNKG2-D type II integral membrane protein; NK cell receptor D; NKG2-D-activating NK receptor;
Chromosome12
Map Location12p13.2-p12.3
SummaryNatural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster. [provided by RefSeq, Dec 2010]
OrthologsView orthologs and multiple alignments for KLRK1

Proteins

NKG2-D type II integral membrane protein
Refseq ID:NP_031386
Protein GI:169234653
UniProt ID:P26718
mRNA ID:NM_007360
Length:216
RefSeq Status:
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCP
KNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYI
ENCSTPNTYICMQRTV
 
  logo