MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004859

Record overview

MGPD IDMGP004859
Gene ID26517
SpeciesHomo sapiens (Human)
Gene Nametranslocase of inner mitochondrial membrane 13 homolog (yeast)
Gene Symbol TIMM13
Synonymsppv1; TIM13; TIM13B; TIMM13A; TIMM13B;
Alternate namesmitochondrial import inner membrane translocase subunit Tim13; mitochondrial import inner membrane translocase subunit Tim13B;
Chromosome19
Map Location19p13.3
SummaryThis gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space. [provided by RefSeq, Jul 2013]
OrthologsView orthologs and multiple alignments for TIMM13

Proteins

mitochondrial import inner membrane translocase subunit Tim13
Refseq ID:NP_036590
Protein GI:11024700
UniProt ID:Q9Y5L4
mRNA ID:NM_012458
Length:95
RefSeq Status:
MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
 
  logo