MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004972

Record overview

MGPD IDMGP004972
Gene ID28957
SpeciesHomo sapiens (Human)
Gene Namemitochondrial ribosomal protein S28
Gene Symbol MRPS28
SynonymsMRPS35; HSPC007; MRP-S28; MRP-S35;
Alternate names28S ribosomal protein S28, mitochondrial; 28S ribosomal protein S35, mitochondrial; S28mt; S35mt; mitochondrial 28S ribosomal protein S35;
Chromosome8
Map Location8q21.1-q21.2
SummaryMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for MRPS28

Proteins

28S ribosomal protein S28, mitochondrial
Refseq ID:NP_054737
Protein GI:7661730
UniProt ID:Q9Y2Q9
mRNA ID:NM_014018
Length:187
RefSeq Status:
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLV
IGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
 
  logo