MGP Database

MGP004979

Record overview

MGPD IDMGP004979
Gene ID28977
SpeciesHomo sapiens (Human)
Gene Namemitochondrial ribosomal protein L42
Gene Symbol MRPL42
SynonymsL31MT; L42MT; S32MT; MRPL31; MRPS32; PTD007; RPML31; HSPC204; MRP-L31; MRP-L42; MRP-S32;
Alternate names39S ribosomal protein L42, mitochondrial; 28S ribosomal protein S32, mitochondrial; 39S ribosomal protein L31, mitochondrial;
Chromosome12
Map Location12q22
SummaryMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q. [provided by RefSeq, May 2011]
OrthologsView orthologs and multiple alignments for MRPL42

Proteins

39S ribosomal protein L42, mitochondrial precursor
Refseq ID:NP_751917
Protein GI:26667171
UniProt ID:Q9Y6G3
mRNA ID:NM_172177
Length:142
RefSeq Status:
MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKV
EHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
 
transit_peptide: 1..32
inference: non-experimental evidence, no additional details recorded
note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q9Y6G3.1)
calculated_mol_wt: 3615
peptide sequence: 
MAVAAVKWVMSKRTILKHLFPVQNGALYCVCH

mat_peptide: 33..142
product: 39S ribosomal protein L42, mitochondrial
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q9Y6G3.1)
calculated_mol_wt: 13064
peptide sequence: 
KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRC
RKNLNPPKDR transit_peptide: 1..32 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q9Y6G3.1) calculated_mol_wt: 3615 peptide sequence: MAVAAVKWVMSKRTILKHLFPVQNGALYCVCH mat_peptide: 33..142 product: 39S ribosomal protein L42, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9Y6G3.1) calculated_mol_wt: 13064 peptide sequence: KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRC
RKNLNPPKDR
 
39S ribosomal protein L42, mitochondrial precursor
Refseq ID:NP_054769
Protein GI:7662637
UniProt ID:Q9Y6G3
mRNA ID:NM_014050
Length:142
RefSeq Status:
Protein sequence is identical to GI:26667171 (mRNA isoform)
 
transit_peptide: 1..32
inference: non-experimental evidence, no additional details recorded
note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q9Y6G3.1)
calculated_mol_wt: 3615
peptide sequence: 
MAVAAVKWVMSKRTILKHLFPVQNGALYCVCH

mat_peptide: 33..142
product: 39S ribosomal protein L42, mitochondrial
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q9Y6G3.1)
calculated_mol_wt: 13064
peptide sequence: 
KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRC
RKNLNPPKDR
 
  logo