MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP005098

Record overview

MGPD IDMGP005098
Gene ID51021
SpeciesHomo sapiens (Human)
Gene Namemitochondrial ribosomal protein S16
Gene Symbol MRPS16
SynonymsCOXPD2; RPMS16; CGI-132; MRP-S16;
Alternate names28S ribosomal protein S16, mitochondrial; S16mt;
Chromosome10
Map Location10q22.1
SummaryMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for MRPS16

Proteins

28S ribosomal protein S16, mitochondrial
Refseq ID:NP_057149
Protein GI:7705626
UniProt ID:Q9Y3D3
mRNA ID:NM_016065
Length:137
RefSeq Status:
MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLH
PMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
 
  logo