MGP Database

MGP006868

Record overview

MGPD IDMGP006868
Gene ID253827
SpeciesHomo sapiens (Human)
Gene Namemethionine sulfoxide reductase B3
Gene Symbol MSRB3
SynonymsDFNB74;
Alternate namesmethionine-R-sulfoxide reductase B3; methionine-R-sulfoxide reductase B3, mitochondrial;
Chromosome12
Map Location12q14.3
EC Number1.8.4.-
SummaryThe protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010]
OrthologsView orthologs and multiple alignments for MSRB3

Proteins

methionine-R-sulfoxide reductase B3 isoform 1 precursor
Refseq ID:NP_932346
Protein GI:37620216
UniProt ID:Q8IXL7
mRNA ID:NM_198080
Length:192
RefSeq Status:
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKF
DSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
 
sig_peptide: 1..32
inference: non-experimental evidence, no additional details recorded
note: Potential; propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 3346
peptide sequence: 
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQS

mat_peptide: 33..192
product: Methionine-R-sulfoxide reductase B3
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 17374
peptide sequence: 
GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVE
TSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
 
methionine-R-sulfoxide reductase B3 isoform 2 precursor
Refseq ID:NP_001180389
Protein GI:301336162
UniProt ID:Q8IXL7
mRNA ID:NM_001193460
Length:185
RefSeq Status:
MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWP
SFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
 
sig_peptide: 1..32
inference: non-experimental evidence, no additional details recorded
note: Potential; propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 3346
peptide sequence: 
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQS

mat_peptide: 33..192
product: Methionine-R-sulfoxide reductase B3
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 17374
peptide sequence: 
GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVE
TSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL sig_peptide: 1..20 inference: protein motif:SignalP:3.0 note: The cleavage site of the signal peptide has not been experimentally determined. calculated_mol_wt: 2197 peptide sequence: MSAFNLLHLVTKSQPVALRA sig_peptide: 1..20 inference: protein motif:SignalP:3.0 note: The cleavage site of the signal peptide has not been experimentally determined. calculated_mol_wt: 2197 peptide sequence: MSAFNLLHLVTKSQPVALRA
 
methionine-R-sulfoxide reductase B3 isoform 2 precursor
Refseq ID:NP_001026849
Protein GI:73089054
UniProt ID:Q8IXL7
mRNA ID:NM_001031679
Length:185
RefSeq Status:
Protein sequence is identical to GI:301336162 (mRNA isoform)
 
sig_peptide: 1..32
inference: non-experimental evidence, no additional details recorded
note: Potential; propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 3346
peptide sequence: 
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQS

mat_peptide: 33..192
product: Methionine-R-sulfoxide reductase B3
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 17374
peptide sequence: 
GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVE
TSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL sig_peptide: 1..20 inference: protein motif:SignalP:3.0 note: The cleavage site of the signal peptide has not been experimentally determined. calculated_mol_wt: 2197 peptide sequence: MSAFNLLHLVTKSQPVALRA
 
methionine-R-sulfoxide reductase B3 isoform 2 precursor
Refseq ID:NP_001180390
Protein GI:301336164
UniProt ID:Q8IXL7
mRNA ID:NM_001193461
Length:185
RefSeq Status:
Protein sequence is identical to GI:301336162 (mRNA isoform)
 
sig_peptide: 1..32
inference: non-experimental evidence, no additional details recorded
note: Potential; propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 3346
peptide sequence: 
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQS

mat_peptide: 33..192
product: Methionine-R-sulfoxide reductase B3
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q8IXL7.2)
calculated_mol_wt: 17374
peptide sequence: 
GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVE
TSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL sig_peptide: 1..20 inference: protein motif:SignalP:3.0 note: The cleavage site of the signal peptide has not been experimentally determined. calculated_mol_wt: 2197 peptide sequence: MSAFNLLHLVTKSQPVALRA sig_peptide: 1..20 inference: protein motif:SignalP:3.0 note: The cleavage site of the signal peptide has not been experimentally determined. calculated_mol_wt: 2197 peptide sequence: MSAFNLLHLVTKSQPVALRA sig_peptide: 1..20 inference: protein motif:SignalP:3.0 note: The cleavage site of the signal peptide has not been experimentally determined. calculated_mol_wt: 2197 peptide sequence: MSAFNLLHLVTKSQPVALRA
 
  logo