MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP007059

Record overview

MGPD IDMGP007059
Gene ID374291
SpeciesHomo sapiens (Human)
Gene NameNADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)
Gene Symbol NDUFS7
SynonymsPSST; CI-20; MY017; CI-20KD;
Alternate namesNADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial; NADH-coenzyme Q reductase; NADH-ubiquinone oxidoreductase 20 kDa subunit; NADH:ubiquinone oxidoreductase PSST subunit; PSST subunit; complex I 20kDa subunit; complex I, mitochondrial respiratory chain, 20-KD subunit; complex I-20kD;
Chromosome19
Map Location19p13.3
EC Number1.6.5.3
SummaryThis gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for NDUFS7

Proteins

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Refseq ID:NP_077718
Protein GI:187281616
UniProt ID:O75251
mRNA ID:NM_024407
Length:213
RefSeq Status:
MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPR
YDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRK
IKRERRLQIWYRR
 
  logo