MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP007081

Record overview

MGPD IDMGP007081
Gene ID388372
SpeciesHomo sapiens (Human)
Gene Namechemokine (C-C motif) ligand 4-like 1
Gene Symbol CCL4L1
SynonymsLAG1; CCL4L; LAG-1; SCYA4L; AT744.2; SCYA4L1;
Alternate namesC-C motif chemokine 4-like; CC chemokine ligand 4L1; chemokine (C-C motif) ligand 4-like 1, telomeric; lymphocyte activation gene 1; macrophage inflammatory protein-1b2; small inducible cytokine A4-like;
Chromosome17
Map Location17q12
SummaryThis gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]
OrthologsView orthologs and multiple alignments for CCL4L1

Proteins

C-C motif chemokine 4-like precursor
Refseq ID:NP_996890
Protein GI:46275832
UniProt ID:P13236
mRNA ID:NM_207007
Length:92
RefSeq Status:
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
 
sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2395
peptide sequence: 
MKLCVTVLSLLVLVAAFCSLALS
 
  logo