MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000240

Record overview

MGPD IDMGP000240
Gene ID481
SpeciesHomo sapiens (Human)
Gene NameATPase, Na+/K+ transporting, beta 1 polypeptide
Gene Symbol ATP1B1
SynonymsATP1B;
Alternate namessodium/potassium-transporting ATPase subunit beta-1; adenosinetriphosphatase; sodium pump subunit beta-1; Na, K-ATPase beta-1 polypeptide; Beta 1-subunit of Na(+),K(+)-ATPase; sodium/potassium-dependent ATPase beta-1 subunit; sodium/potassium-transporting ATPase beta-1 chain; sodium-potassium ATPase subunit beta 1 (non-catalytic);
Chromosome1
Map Location1q24
SummaryThe protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010]
OrthologsView orthologs and multiple alignments for ATP1B1

Proteins

sodium/potassium-transporting ATPase subunit beta-1
Refseq ID:NP_001668
Protein GI:4502277
UniProt ID:P05026
mRNA ID:NM_001677
Length:303
RefSeq Status:
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEA
YVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYP
VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE
VKS
 
  logo