MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000242

Record overview

MGPD IDMGP000242
Gene ID483
SpeciesHomo sapiens (Human)
Gene NameATPase, Na+/K+ transporting, beta 3 polypeptide
Gene Symbol ATP1B3
SynonymsCD298; ATPB-3;
Alternate namessodium/potassium-transporting ATPase subunit beta-3; sodium pump subunit beta-3; Na, K-ATPase beta-3 polypeptide; sodium/potassium-dependent ATPase beta-3 subunit; sodium/potassium-dependent ATPase subunit beta-3; sodium/potassium-transporting ATPase beta-3 chain; sodium-potassium ATPase subunit beta 3 (non-catalytic);
Chromosome3
Map Location3q23
SummaryThe protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for ATP1B3

Proteins

sodium/potassium-transporting ATPase subunit beta-3
Refseq ID:NP_001670
Protein GI:4502281
UniProt ID:P54709
mRNA ID:NM_001679
Length:279
RefSeq Status:
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDP
TSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPN
VAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
 
  logo