MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000297

Record overview

MGPD IDMGP000297
Gene ID595
SpeciesHomo sapiens (Human)
Gene Namecyclin D1
Gene Symbol CCND1
SynonymsBCL1; PRAD1; U21B31; D11S287E;
Alternate namesG1/S-specific cyclin-D1; BCL-1 oncogene; PRAD1 oncogene; B-cell CLL/lymphoma 1; B-cell lymphoma 1 protein;
Chromosome11
Map Location11q13
SummaryThe protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for CCND1

Proteins

G1/S-specific cyclin-D1
Refseq ID:NP_444284
Protein GI:16950655
UniProt ID:P24385
mRNA ID:NM_053056
Length:295
RefSeq Status:
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQ
LLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPP
SMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
 
  logo