MGP Database

MGP000322

Record overview

MGPD ID	MGP000322
Gene ID	652
Species	Homo sapiens (Human)
Gene Name	bone morphogenetic protein 4
Gene Symbol	BMP4
Synonyms	ZYME; BMP2B; OFC11; BMP2B1; MCOPS6;
Alternate names	bone morphogenetic protein 4; BMP-4; BMP-2B; bone morphogenetic protein 2B;
Chromosome	14
Map Location	14q22-q23
Summary	The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for BMP4

Proteins

bone morphogenetic protein 4 preproprotein

Refseq ID:	NP_001193
Protein GI:	157276593
UniProt ID:	P12644
mRNA ID:	NM_001202
Length:	408
RefSeq Status:

MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIH
STGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLL
DTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEM
VVEGCGCR

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2524
peptide sequence: 
MIPGNRMLMVVLLCQVLLGGASHA

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2524
peptide sequence: 
MIPGNRMLMVVLLCQVLLGGASHA

bone morphogenetic protein 4 preproprotein

Refseq ID:	NP_570911
Protein GI:	157276595
UniProt ID:	P12644
mRNA ID:	NM_130850
Length:	408
RefSeq Status:

Protein sequence is identical to GI:157276593 (mRNA isoform)

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2524
peptide sequence: 
MIPGNRMLMVVLLCQVLLGGASHA

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2524
peptide sequence: 
MIPGNRMLMVVLLCQVLLGGASHA

sig_peptide: 1..24
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2524
peptide sequence: 
MIPGNRMLMVVLLCQVLLGGASHA

bone morphogenetic protein 4 preproprotein

Refseq ID:	NP_570912
Protein GI:	157276597
UniProt ID:	P12644
mRNA ID:	NM_130851
Length:	408
RefSeq Status:

Protein sequence is identical to GI:157276593 (mRNA isoform)

`sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2524 peptide sequence: MIPGNRMLMVVLLCQVLLGGASHA`