MGP Database

MGP000468

Record overview

MGPD ID	MGP000468
Gene ID	966
Species	Homo sapiens (Human)
Gene Name	CD59 molecule, complement regulatory protein
Gene Symbol	CD59
Synonyms	1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20;
Alternate names	CD59 glycoprotein; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal antibody 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344);
Chromosome	11
Map Location	11p13
Summary	This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for CD59

Proteins

CD59 glycoprotein preproprotein

Refseq ID:	NP_000602
Protein GI:	10835165
UniProt ID:	P13987
mRNA ID:	NM_000611
Length:	128
RefSeq Status:

`MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQL ENGGTSLSEKTVLLLVTPFLAAAWSLHP`

sig_peptide: 1..25
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2543
peptide sequence: 
MGIQGGSVLFGLLLVLAVFCHSGHS

mat_peptide: 26..102
product: CD59 glycoprotein
calculated_mol_wt: 8961
peptide sequence: 
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

sig_peptide: 1..25
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2543
peptide sequence: 
MGIQGGSVLFGLLLVLAVFCHSGHS

mat_peptide: 26..102
product: CD59 glycoprotein
calculated_mol_wt: 8961
peptide sequence: 
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

sig_peptide: 1..25
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2543
peptide sequence: 
MGIQGGSVLFGLLLVLAVFCHSGHS

mat_peptide: 26..102
product: CD59 glycoprotein
calculated_mol_wt: 8961
peptide sequence: 
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

sig_peptide: 1..25
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2543
peptide sequence: 
MGIQGGSVLFGLLLVLAVFCHSGHS

mat_peptide: 26..102
product: CD59 glycoprotein
calculated_mol_wt: 8961
peptide sequence: 
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN