MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000512

Record overview

MGPD IDMGP000512
Gene ID1026
SpeciesHomo sapiens (Human)
Gene Namecyclin-dependent kinase inhibitor 1A (p21, Cip1)
Gene Symbol CDKN1A
SynonymsP21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1;
Alternate namescyclin-dependent kinase inhibitor 1; DNA synthesis inhibitor; CDK-interacting protein 1; CDK-interaction protein 1; wild-type p53-activated fragment 1; melanoma differentiation associated protein 6;
Chromosome6
Map Location6p21.2
SummaryThis gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-CDK2 or -CDK4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen (PCNA), a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of CDK2, and may be instrumental in the execution of apoptosis following caspase activation. Multiple alternatively spliced variants have been found for this gene. [provided by RefSeq, Nov 2010]
OrthologsView orthologs and multiple alignments for CDKN1A

Proteins

cyclin-dependent kinase inhibitor 1 isoform 1
Refseq ID:NP_000380
Protein GI:11386203
UniProt ID:P38936
mRNA ID:NM_000389
Length:164
RefSeq Status:
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPA
LLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
 
cyclin-dependent kinase inhibitor 1 isoform 1
Refseq ID:NP_001207707
Protein GI:334085242
UniProt ID:P38936
mRNA ID:NM_001220778
Length:164
RefSeq Status:
Protein sequence is identical to GI:11386203 (mRNA isoform)
 
cyclin-dependent kinase inhibitor 1 isoform 1
Refseq ID:NP_001207706
Protein GI:334085240
UniProt ID:P38936
mRNA ID:NM_001220777
Length:164
RefSeq Status:
Protein sequence is identical to GI:11386203 (mRNA isoform)
 
cyclin-dependent kinase inhibitor 1 isoform 1
Refseq ID:NP_510867
Protein GI:17978495
UniProt ID:P38936
mRNA ID:NM_078467
Length:164
RefSeq Status:
Protein sequence is identical to GI:11386203 (mRNA isoform)
 
cyclin-dependent kinase inhibitor 1 isoform 2
Refseq ID:NP_001278478
Protein GI:614458211
UniProt ID:P38936
mRNA ID:NM_001291549
Length:198
RefSeq Status:
MWGVFRRQTTHSSNPPLPGQQSCCNHRDFFCSGAMSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWE
RVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
 
  logo