MGP Database

MGP000755

Record overview

MGPD ID	MGP000755
Gene ID	1559
Species	Homo sapiens (Human)
Gene Name	cytochrome P450, family 2, subfamily C, polypeptide 9
Gene Symbol	CYP2C9
Synonyms	CPC9; CYP2C; CYP2C10; CYPIIC9; P450IIC9;
Alternate names	cytochrome P450 2C9; cytochrome P-450 S-mephenytoin 4-hydroxylase; cytochrome P-450MP; cytochrome P450 PB-1; flavoprotein-linked monooxygenase; microsomal monooxygenase; xenobiotic monooxygenase;
Chromosome	10
Map Location	10q24
EC Number	1.14.13.-
Summary	This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that this gene is polymorphic. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. [provided by RefSeq, Jul 2008]
Orthologs	View orthologs and multiple alignments for CYP2C9

Proteins

cytochrome P450 2C9 precursor

Refseq ID:	NP_000762
Protein GI:	13699818
UniProt ID:	P11712
mRNA ID:	NM_000771
Length:	490
RefSeq Status:

MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIF
PLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFHKRFDYKDQQFLNLMEK
LNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFMKSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKE
FPNPEMFDPHHFLDEGGNFKKSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

`sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2749 peptide sequence: MDSLVVLVLCLSCLLLLSLWRQSSG`