MGP Database

MGP000817

Record overview

MGPD ID	MGP000817
Gene ID	1671
Species	Homo sapiens (Human)
Gene Name	defensin, alpha 6, Paneth cell-specific
Gene Symbol	DEFA6
Synonyms	DEF6; HD-6;
Alternate names	defensin-6; defensin 6;
Chromosome	8
Map Location	8p23.1
Summary	Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq, Oct 2014]
Orthologs	View orthologs and multiple alignments for DEFA6

Proteins

defensin-6 preproprotein

Refseq ID:	NP_001917
Protein GI:	4503305
UniProt ID:	Q01524
mRNA ID:	NM_001926
Length:	100
RefSeq Status:

`MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL`

sig_peptide: 1..19
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2027
peptide sequence: 
MRTLTILTAVLLVALQAKA

mat_peptide: 69..100
product: defensin-6
experiment: DESCRIPTION:antimicrobial peptide[PMID: 22722251]
calculated_mol_wt: 3714
peptide sequence: 
AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL