MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP000887

Record overview

MGPD IDMGP000887
Gene ID1845
SpeciesHomo sapiens (Human)
Gene Namedual specificity phosphatase 3
Gene Symbol DUSP3
SynonymsVHR;
Alternate namesdual specificity protein phosphatase 3; vaccinia H1-related phosphatase; vaccinia virus phosphatase VH1-related; dual specificity protein phosphatase VHR; serine/threonine specific protein phosphatase;
Chromosome17
Map Location17q21
EC Number3.1.3.16
SummaryThe protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for DUSP3

Proteins

dual specificity protein phosphatase 3
Refseq ID:NP_004081
Protein GI:4758208
UniProt ID:P51452
mRNA ID:NM_004090
Length:185
RefSeq Status:
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSA
YFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
 
  logo