MGP Database

MGP000948

Record overview

MGPD ID	MGP000948
Gene ID	2002
Species	Homo sapiens (Human)
Gene Name	ELK1, member of ETS oncogene family
Gene Symbol	ELK1
Alternate names	ETS domain-containing protein Elk-1; ETS-like gene 1; tyrosine kinase (ELK1) oncogene;
Chromosome	X
Map Location	Xp11.2
Summary	This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. [provided by RefSeq, Mar 2012]
Orthologs	View orthologs and multiple alignments for ELK1

Proteins

ETS domain-containing protein Elk-1 isoform a

Refseq ID:	NP_005220
Protein GI:	166362730
UniProt ID:	P19419
mRNA ID:	NM_005229
Length:	428
RefSeq Status:

MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCP
PQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTS
PSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSS
GSAQVHIPSISVDGLSTPVVLSPGPQKP

ETS domain-containing protein Elk-1 isoform a

Refseq ID:	NP_001107595
Protein GI:	166362732
UniProt ID:	P19419
mRNA ID:	NM_001114123
Length:	428
RefSeq Status:

ETS domain-containing protein Elk-1 isoform b
Protein sequence is identical to GI:166362730 (mRNA isoform)

Refseq ID:	NP_001244097
Protein GI:	380422416
UniProt ID:	P19419
mRNA ID:	NM_001257168
Length:	95
RefSeq Status:

`MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPESHCAP`