MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001081

Record overview

MGPD IDMGP001081
Gene ID2274
SpeciesHomo sapiens (Human)
Gene Namefour and a half LIM domains 2
Gene Symbol FHL2
SynonymsDRAL; AAG11; FHL-2; SLIM3; SLIM-3;
Alternate namesfour and a half LIM domains protein 2; LIM domain protein DRAL; aging-associated gene 11; down-regulated in rhabdomyosarcoma LIM protein; skeletal muscle LIM-protein 3;
Chromosome2
Map Location2q12.2
SummaryThis gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011]
OrthologsView orthologs and multiple alignments for FHL2

Proteins

four and a half LIM domains protein 2
Refseq ID:NP_963849
Protein GI:42403575
UniProt ID:Q14192
mRNA ID:NM_201555
Length:279
RefSeq Status:
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSK
CQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRF
TARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
 
four and a half LIM domains protein 2
Refseq ID:NP_963851
Protein GI:87159834
UniProt ID:Q14192
mRNA ID:NM_201557
Length:279
RefSeq Status:
Protein sequence is identical to GI:42403575 (mRNA isoform)
 
four and a half LIM domains protein 2
Refseq ID:NP_001034581
Protein GI:87159836
UniProt ID:Q14192
mRNA ID:NM_001039492
Length:279
RefSeq Status:
Protein sequence is identical to GI:42403575 (mRNA isoform)
 
four and a half LIM domains protein 2
Refseq ID:NP_001441
Protein GI:87159832
UniProt ID:Q14192
mRNA ID:NM_001450
Length:279
RefSeq Status:
Protein sequence is identical to GI:42403575 (mRNA isoform)
 
  logo