MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001095

Record overview

MGPD IDMGP001095
Gene ID2328
SpeciesHomo sapiens (Human)
Gene Nameflavin containing monooxygenase 3
Gene Symbol FMO3
SynonymsTMAU; FMOII; dJ127D3.1;
Alternate namesdimethylaniline monooxygenase [N-oxide-forming] 3; FMO 3; FMO II; FMO form 2; dimethylaniline oxidase 3; hepatic flavin-containing monooxygenase 3; hepatic flavin-containing monooxygenase-3; trimethylamine monooxygenase;
Chromosome1
Map Location1q24.3
EC Number1.14.13.8
SummaryFlavin-containing monooxygenases (FMO) are an important class of drug-metabolizing enzymes that catalyze the NADPH-dependent oxygenation of various nitrogen-,sulfur-, and phosphorous-containing xenobiotics such as therapeutic drugs, dietary compounds, pesticides, and other foreign compounds. The human FMO gene family is composed of 5 genes and multiple pseudogenes. FMO members have distinct developmental- and tissue-specific expression patterns. The expression of this FMO3 gene, the major FMO expressed in adult liver, can vary up to 20-fold between individuals. This inter-individual variation in FMO3 expression levels is likely to have significant effects on the rate at which xenobiotics are metabolised and, therefore, is of considerable interest to the pharmaceutical industry. This transmembrane protein localizes to the endoplasmic reticulum of many tissues. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. Mutations in this gene cause the disorder trimethylaminuria (TMAu) which is characterized by the accumulation and excretion of unmetabolized trimethylamine and a distinctive body odor. In healthy individuals, trimethylamine is primarily converted to the non odorous trimethylamine N-oxide.[provided by RefSeq, Aug 2009]
OrthologsView orthologs and multiple alignments for FMO3

Proteins

dimethylaniline monooxygenase [N-oxide-forming] 3
Refseq ID:NP_001002294
Protein GI:50541961
UniProt ID:P31513
mRNA ID:NM_001002294
Length:532
RefSeq Status:
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNL
LKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIA
TELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLP
SMEDMMNDINEKMEKKRKWFGKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQWDRSLKPMQTR
VVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
 
dimethylaniline monooxygenase [N-oxide-forming] 3
Refseq ID:NP_008825
Protein GI:50541965
UniProt ID:P31513
mRNA ID:NM_006894
Length:532
RefSeq Status:
Protein sequence is identical to GI:50541961 (mRNA isoform)
 
  logo