MGP Database

MGP001338

Record overview

MGPD ID	MGP001338
Gene ID	2921
Species	Homo sapiens (Human)
Gene Name	chemokine (C-X-C motif) ligand 3
Gene Symbol	CXCL3
Synonyms	GRO3; GROg; MIP2B; SCYB3; MIP-2b; CINC-2b;
Alternate names	C-X-C motif chemokine 3; GRO-gamma; GRO-gamma(1-73); GRO3 oncogene; MGSA gamma; MIP2-beta; growth-regulated protein gamma; macrophage inflammatory protein 2-beta; melanoma growth stimulatory activity gamma;
Chromosome	4
Map Location	4q21
Summary	This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. [provided by RefSeq, Sep 2014]
Orthologs	View orthologs and multiple alignments for CXCL3

Proteins

C-X-C motif chemokine 3 precursor

Refseq ID:	NP_002081
Protein GI:	54144650
UniProt ID:	P19876
mRNA ID:	NM_002090
Length:	107
RefSeq Status:

`MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKI LNKGSTN`

sig_peptide: 1..34
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 3495
peptide sequence: 
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAG

mat_peptide: 35..107
product: C-X-C motif chemokine 3
experiment: DESCRIPTION:antimicrobial peptide[PMID: 12949249]
calculated_mol_wt: 7865
peptide sequence: 
ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN