MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001348

Record overview

MGPD IDMGP001348
Gene ID2938
SpeciesHomo sapiens (Human)
Gene Nameglutathione S-transferase alpha 1
Gene Symbol GSTA1
SynonymsGST2; GTH1; GSTA1-1;
Alternate namesglutathione S-transferase A1; GST HA subunit 1; GST class-alpha member 1; GST, class alpha, 1; GST-epsilon; S-(hydroxyalkyl)glutathione lyase A1; glutathione S-alkyltransferase A1; glutathione S-aryltransferase A1; glutathione S-transferase 2; glutathione S-transferase Ha subunit 1;
Chromosome6
Map Location6p12.1
EC Number2.5.1.18
SummaryCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for GSTA1

Proteins

glutathione S-transferase A1
Refseq ID:NP_665683
Protein GI:22091454
UniProt ID:P08263
mRNA ID:NM_145740
Length:222
RefSeq Status:
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIA
DLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQP
GSPRKPPMDEKSLEEARKIFRF
 
  logo