MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001349

Record overview

MGPD IDMGP001349
Gene ID2939
SpeciesHomo sapiens (Human)
Gene Nameglutathione S-transferase alpha 2
Gene Symbol GSTA2
SynonymsGST2; GTA2; GTH2; GSTA2-2;
Alternate namesglutathione S-transferase A2; GST HA subunit 2; GST class-alpha member 2; GST-gamma; S-(hydroxyalkyl)glutathione lyase A2; glutathione S-alkyltransferase A2; glutathione S-aralkyltransferase A2; glutathione S-aryltransferase A2; liver GST2;
Chromosome6
Map Location6p12.1
EC Number2.5.1.18
SummaryCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for GSTA2

Proteins

glutathione S-transferase A2
Refseq ID:NP_000837
Protein GI:215276987
UniProt ID:P09210
mRNA ID:NM_000846
Length:222
RefSeq Status:
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA
DLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQP
GSPRKPPMDEKSLEESRKIFRF
 
  logo