MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001350

Record overview

MGPD IDMGP001350
Gene ID2940
SpeciesHomo sapiens (Human)
Gene Nameglutathione S-transferase alpha 3
Gene Symbol GSTA3
SynonymsGTA3; GSTA3-3;
Alternate namesglutathione S-transferase A3; GST class-alpha member 3; S-(hydroxyalkyl)glutathione lyase A3; glutathione S-alkyltransferase A3; glutathione S-aralkyltransferase A3; glutathione S-aryltransferase A3; glutathione S-transferase A3-3;
Chromosome6
Map Location6p12.1
EC Number2.5.1.18
SummaryCytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for GSTA3

Proteins

glutathione S-transferase A3
Refseq ID:NP_000838
Protein GI:24430144
UniProt ID:Q16772
mRNA ID:NM_000847
Length:222
RefSeq Status:
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMA
DLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP
GSPRKPPADAKALEEARKIFRF
 
  logo